Lineage for d1ezzc2 (1ezz C:151-310)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493157Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)
  8. 493295Domain d1ezzc2: 1ezz C:151-310 [35193]
    Other proteins in same PDB: d1ezzb1, d1ezzb2, d1ezzd1, d1ezzd2

Details for d1ezzc2

PDB Entry: 1ezz (more details), 2.7 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state

SCOP Domain Sequences for d1ezzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezzc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplarv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOP Domain Coordinates for d1ezzc2:

Click to download the PDB-style file with coordinates for d1ezzc2.
(The format of our PDB-style files is described here.)

Timeline for d1ezzc2: