Lineage for d5tr8l2 (5tr8 L:108-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 3051866Domain d5tr8l2: 5tr8 L:108-212 [351928]
    Other proteins in same PDB: d5tr8l1
    automated match to d5vzrb2
    complexed with ni

Details for d5tr8l2

PDB Entry: 5tr8 (more details), 2.01 Å

PDB Description: crystal structure of vaccine-elicited pan- influenza h1n1 neutralizing murine antibody 441d6.
PDB Compounds: (L:) 441D6 Fab Light chain

SCOPe Domain Sequences for d5tr8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr8l2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5tr8l2:

Click to download the PDB-style file with coordinates for d5tr8l2.
(The format of our PDB-style files is described here.)

Timeline for d5tr8l2:

  • d5tr8l2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10