Lineage for d5obwa2 (5obw A:167-366)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (54 species)
    not a true protein
  7. 3051827Species Mycoplasma genitalium [TaxId:243273] [351889] (3 PDB entries)
  8. 3051862Domain d5obwa2: 5obw A:167-366 [351924]
    Other proteins in same PDB: d5obwa3
    automated match to d5fpeb2
    complexed with adp, gol, mg, po4, scn, so4

Details for d5obwa2

PDB Entry: 5obw (more details), 1.4 Å

PDB Description: mycoplasma genitalium dnak-nbd in complex with atp
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d5obwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obwa2 c.55.1.0 (A:167-366) automated matches {Mycoplasma genitalium [TaxId: 243273]}
asremkvlvydlgggtfdvslldiaegtfevlatagdnrlggddwdnkiieyisayiake
hqglnlskdkmamqrlkeaaerakielsaqletiislpfltvtqkgpvnvelkltrakfe
eltkpllertrnpisdvikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsi
npdevvaigaaiqggvlrgd

SCOPe Domain Coordinates for d5obwa2:

Click to download the PDB-style file with coordinates for d5obwa2.
(The format of our PDB-style files is described here.)

Timeline for d5obwa2:

  • d5obwa2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10