Lineage for d5tfba_ (5tfb A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2450650Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2450666Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2450667Species Human (Homo sapiens) [TaxId:9606] [117543] (20 PDB entries)
    Uniprot P13569 389-671
  8. 3051860Domain d5tfba_: 5tfb A: [351922]
    automated match to d2pzga_
    complexed with mg, mgp

Details for d5tfba_

PDB Entry: 5tfb (more details), 1.87 Å

PDB Description: nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (cftr) with 7-methyl-gtp
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d5tfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tfba_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
tevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepsegk
ikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdnivl
geggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktri
lvtskmehlkkadkililhegssyfygtfselqnl

SCOPe Domain Coordinates for d5tfba_:

Click to download the PDB-style file with coordinates for d5tfba_.
(The format of our PDB-style files is described here.)

Timeline for d5tfba_:

  • d5tfba_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-10