Lineage for d5svha_ (5svh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309862Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 2309863Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 2309864Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 2309865Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 2309866Species Mouse (Mus musculus) [TaxId:10090] [47043] (11 PDB entries)
  8. 3051856Domain d5svha_: 5svh A: [351918]
    automated match to d1sb0a_
    complexed with cl, gol

Details for d5svha_

PDB Entry: 5svh (more details), 2.05 Å

PDB Description: crystal structure of the kix domain of cbp in complex with a mll/c-myb chimera
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5svha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svha_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
rkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrd
eyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d5svha_:

Click to download the PDB-style file with coordinates for d5svha_.
(The format of our PDB-style files is described here.)

Timeline for d5svha_:

  • d5svha_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-10