Lineage for d5obxa2 (5obx A:167-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885386Species Mycoplasma genitalium [TaxId:243273] [351889] (3 PDB entries)
  8. 2885392Domain d5obxa2: 5obx A:167-366 [351916]
    Other proteins in same PDB: d5obxa3
    automated match to d5fpeb2
    complexed with gol, pge, so4

Details for d5obxa2

PDB Entry: 5obx (more details), 1.78 Å

PDB Description: mycoplasma genitalium dnak-nbd
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d5obxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obxa2 c.55.1.0 (A:167-366) automated matches {Mycoplasma genitalium [TaxId: 243273]}
asremkvlvydlgggtfdvslldiaegtfevlatagdnrlggddwdnkiieyisayiake
hqgknlskdkmamqrlkeaaerakielsaqletiislpfltvtqkgpvnvelkltrakfe
eltkpllertrnpisdvikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsi
npdevvaigaaiqggvlrgd

SCOPe Domain Coordinates for d5obxa2:

Click to download the PDB-style file with coordinates for d5obxa2.
(The format of our PDB-style files is described here.)

Timeline for d5obxa2: