Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Mycoplasma genitalium [TaxId:243273] [351889] (3 PDB entries) |
Domain d5obxa2: 5obx A:167-366 [351916] Other proteins in same PDB: d5obxa3 automated match to d5fpeb2 complexed with gol, pge, so4 |
PDB Entry: 5obx (more details), 1.78 Å
SCOPe Domain Sequences for d5obxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5obxa2 c.55.1.0 (A:167-366) automated matches {Mycoplasma genitalium [TaxId: 243273]} asremkvlvydlgggtfdvslldiaegtfevlatagdnrlggddwdnkiieyisayiake hqgknlskdkmamqrlkeaaerakielsaqletiislpfltvtqkgpvnvelkltrakfe eltkpllertrnpisdvikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsi npdevvaigaaiqggvlrgd
Timeline for d5obxa2: