Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries) |
Domain d5vtac2: 5vta C:510-766 [351910] Other proteins in same PDB: d5vtaa1, d5vtab1, d5vtac1, d5vtad1, d5vtae1, d5vtae2, d5vtaf_, d5vtag_, d5vtah_, d5vtai_, d5vtaj_, d5vtak_, d5vtal1, d5vtal2 automated match to d4ffvb2 complexed with 9k4, edo, nag, peg, pg4 |
PDB Entry: 5vta (more details), 2.8 Å
SCOPe Domain Sequences for d5vtac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vtac2 c.69.1.0 (C:510-766) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah qhiyshmshflqqcfsl
Timeline for d5vtac2: