Lineage for d5vtac2 (5vta C:510-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902577Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries)
  8. 2902588Domain d5vtac2: 5vta C:510-766 [351910]
    Other proteins in same PDB: d5vtaa1, d5vtab1, d5vtac1, d5vtad1, d5vtae1, d5vtae2, d5vtaf_, d5vtag_, d5vtah_, d5vtai_, d5vtaj_, d5vtak_, d5vtal1, d5vtal2
    automated match to d4ffvb2
    complexed with 9k4, edo, nag, peg, pg4

Details for d5vtac2

PDB Entry: 5vta (more details), 2.8 Å

PDB Description: co-crystal structure of dppiv with a chemibody inhibitor
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5vtac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtac2 c.69.1.0 (C:510-766) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfsl

SCOPe Domain Coordinates for d5vtac2:

Click to download the PDB-style file with coordinates for d5vtac2.
(The format of our PDB-style files is described here.)

Timeline for d5vtac2: