Lineage for d6ck3a1 (6ck3 A:72-371)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (994 PDB entries)
  8. 3051840Domain d6ck3a1: 6ck3 A:72-371 [351902]
    Other proteins in same PDB: d6ck3a2
    automated match to d2hw6a_
    complexed with cl, f67, zn

Details for d6ck3a1

PDB Entry: 6ck3 (more details), 2.9 Å

PDB Description: co-crytsal structure of mnk2 in complex with an inhibitor
PDB Compounds: (A:) MAP kinase-interacting serine/threonine-protein kinase 2

SCOPe Domain Sequences for d6ck3a1:

Sequence, based on SEQRES records: (download)

>d6ck3a1 d.144.1.0 (A:72-371) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfglgsgiklngdcspistpelltpc
gsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrgeac
pacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvqgc

Sequence, based on observed residues (ATOM records): (download)

>d6ck3a1 d.144.1.0 (A:72-371) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfggsaeymapevveafseeasiydk
rcdlwslgvilyillsgyppfvgrccgacpacqnmlfesiqegkyefpdkdwahiscaak
dliskllvrdakqrlsaaqvlqhpwvqgc

SCOPe Domain Coordinates for d6ck3a1:

Click to download the PDB-style file with coordinates for d6ck3a1.
(The format of our PDB-style files is described here.)

Timeline for d6ck3a1:

  • d6ck3a1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6ck3a2