SCOPe 2.08: Domain d5tf8a_: 5tf8 A:

Lineage for d5tf8a_ (5tf8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
   Uniprot P13569 389-671

8. Domain d5tf8a_: 5tf8 A: [351898]
   automated match to d2pzga_
   complexed with mg, ttp

Details for d5tf8a_

PDB Entry: 5tf8, 1.86 Å

PDB Description: nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance regulator (cftr) with dttp

PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d5tf8a_:

Sequence; same for both SEQRES and ATOM records:

>d5tf8a_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepseg
kikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdniv
lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr
ilvtskmehlkkadkililhegssyfygtfselqnlqp

Timeline for d5tf8a_:

• d5tf8a_ first appeared in SCOPe 2.07