Lineage for d5obya1 (5oby A:4-166)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885386Species Mycoplasma genitalium [TaxId:243273] [351889] (3 PDB entries)
  8. 2885387Domain d5obya1: 5oby A:4-166 [351890]
    Other proteins in same PDB: d5obya3
    automated match to d5fpeb1
    complexed with anp, gol, mg, so4

Details for d5obya1

PDB Entry: 5oby (more details), 1.3 Å

PDB Description: mycoplasma genitalium dnak-nbd in complex with amp-pnp
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d5obya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obya1 c.55.1.0 (A:4-166) automated matches {Mycoplasma genitalium [TaxId: 243273]}
dngliigidlgttnscvsvmeggrpvvlenpegkrttpsivsyknneiivgdaakrqmvt
npntivsikrlmgtsnkvkvqnadgttkelspeqvsaqilsylkdfaekkigkkisravi
tvpayfndaernatktagkiaglnveriineptaaalaygidk

SCOPe Domain Coordinates for d5obya1:

Click to download the PDB-style file with coordinates for d5obya1.
(The format of our PDB-style files is described here.)

Timeline for d5obya1: