Lineage for d6d8wd2 (6d8w D:334-486)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (23 species)
    not a true protein
  7. 3051776Species Influenza a virus [TaxId:947380] [351838] (1 PDB entry)
  8. 3051821Domain d6d8wd2: 6d8w D:334-486 [351883]
    Other proteins in same PDB: d6d8wa1, d6d8wb1, d6d8wb3, d6d8wb4, d6d8wc1, d6d8wc3, d6d8wd1, d6d8we1, d6d8wf1
    automated match to d4wsrd2
    complexed with fmt, nag, oxm

Details for d6d8wd2

PDB Entry: 6d8w (more details), 2.35 Å

PDB Description: crystal structure of invbi.18715.a.kn11: influenza hemagglutinin from strain a/jiangsu/alsi/2011
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6d8wd2:

Sequence, based on SEQRES records: (download)

>d6d8wd2 h.3.1.0 (D:334-486) automated matches {Influenza a virus [TaxId: 947380]}
aiagfieggwtgmvdgwygyhhrneqgsgyaadqkstqiaidgisnkvnsviekmniqft
svgkefnslekrmenlnkkvddgfldvwtynaellillenertldfhdlnvknlyekvks
qlrnnakeigngcfefyhkcdnecmesvkngty

Sequence, based on observed residues (ATOM records): (download)

>d6d8wd2 h.3.1.0 (D:334-486) automated matches {Influenza a virus [TaxId: 947380]}
aiagfieggwtgmvdgwygyyaadqkstqiaidgisnkvnsviekmniqftsvgkefnsl
ekrmenlnkkvddgfldvwtynaellillenertldfhdlnvknlyekvksqlrnnakme
svkngty

SCOPe Domain Coordinates for d6d8wd2:

Click to download the PDB-style file with coordinates for d6d8wd2.
(The format of our PDB-style files is described here.)

Timeline for d6d8wd2:

  • d6d8wd2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10