Lineage for d5ltla_ (5ltl A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499623Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2499624Protein automated matches [190775] (3 species)
    not a true protein
  7. 2499625Species Human (Homo sapiens) [TaxId:9606] [188003] (11 PDB entries)
  8. 3051819Domain d5ltla_: 5ltl A: [351881]
    automated match to d1huna_
    complexed with gol, na

Details for d5ltla_

PDB Entry: 5ltl (more details), 1.45 Å

PDB Description: structure of human chemokine ccl16
PDB Compounds: (A:) C-C motif chemokine 16

SCOPe Domain Sequences for d5ltla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltla_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpnddwvqeyikd
pnlpllpt

SCOPe Domain Coordinates for d5ltla_:

Click to download the PDB-style file with coordinates for d5ltla_.
(The format of our PDB-style files is described here.)

Timeline for d5ltla_:

  • d5ltla_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09