Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces coelicolor [TaxId:100226] [351874] (1 PDB entry) |
Domain d6by3c1: 6by3 C:26-116 [351875] Other proteins in same PDB: d6by3b1, d6by3b2, d6by3c2 automated match to d5vk6c_ complexed with dga, f09, k; mutant |
PDB Entry: 6by3 (more details), 2.37 Å
SCOPe Domain Sequences for d6by3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6by3c1 f.14.1.1 (C:26-116) Potassium channel protein {Streptomyces coelicolor [TaxId: 100226]} wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt lwgrcvavvvmvagitsfglvtaalatwfvg
Timeline for d6by3c1: