SCOPe 2.07: Domain d6by3c1: 6by3 C:26-116

Lineage for d6by3c1 (6by3 C:26-116)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces coelicolor [TaxId:100226] [351874] (1 PDB entry)

8. Domain d6by3c1: 6by3 C:26-116 [351875]
   Other proteins in same PDB: d6by3b1, d6by3b2, d6by3c2
   automated match to d5vk6c_
   complexed with dga, f09, k; mutant

Details for d6by3c1

PDB Entry: 6by3, 2.37 Å

PDB Description: open and conductive conformation of kcsa-t75a mutant

PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6by3c1:

Sequence; same for both SEQRES and ATOM records:

>d6by3c1 f.14.1.1 (C:26-116) Potassium channel protein {Streptomyces coelicolor [TaxId: 100226]}
wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt
lwgrcvavvvmvagitsfglvtaalatwfvg

Timeline for d6by3c1:

• d6by3c1 is new in SCOPe 2.07-stable
  
• d6by3c1 appears in the current release, SCOPe 2.08