Lineage for d6by3c1 (6by3 C:26-116)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 3051812Species Streptomyces coelicolor [TaxId:100226] [351874] (1 PDB entry)
  8. 3051813Domain d6by3c1: 6by3 C:26-116 [351875]
    Other proteins in same PDB: d6by3b1, d6by3b2, d6by3c2
    automated match to d5vk6c_
    complexed with dga, f09, k; mutant

Details for d6by3c1

PDB Entry: 6by3 (more details), 2.37 Å

PDB Description: open and conductive conformation of kcsa-t75a mutant
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6by3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6by3c1 f.14.1.1 (C:26-116) Potassium channel protein {Streptomyces coelicolor [TaxId: 100226]}
wrcagaatvllvivllagsylavlaergapgaqlitypralwwsvetatavgygdlypvt
lwgrcvavvvmvagitsfglvtaalatwfvg

SCOPe Domain Coordinates for d6by3c1:

Click to download the PDB-style file with coordinates for d6by3c1.
(The format of our PDB-style files is described here.)

Timeline for d6by3c1:

  • d6by3c1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-09

View in 3D
Domains from same chain:
(mouse over for more information)
d6by3c2