Lineage for d5o1db_ (5o1d B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2364216Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2364217Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2364218Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2364219Species Human (Homo sapiens) [TaxId:9606] [49420] (50 PDB entries)
  8. 3051809Domain d5o1db_: 5o1d B: [351871]
    automated match to d2feja_
    protein/DNA complex; complexed with 9gw, gol, zn; mutant

Details for d5o1db_

PDB Entry: 5o1d (more details), 1.36 Å

PDB Description: p53 cancer mutant y220c in complex with compound mb481
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d5o1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o1db_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
cacpgrdrrteeenlrk

SCOPe Domain Coordinates for d5o1db_:

Click to download the PDB-style file with coordinates for d5o1db_.
(The format of our PDB-style files is described here.)

Timeline for d5o1db_:

  • d5o1db_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09