SCOPe 2.08: Domain d5ltlb_: 5ltl B:

Lineage for d5ltlb_ (5ltl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.0: automated matches [191483] (1 protein)
   not a true family

6. Protein automated matches [190775] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)

8. Domain d5ltlb_: 5ltl B: [351870]
   automated match to d1huna_
   complexed with gol, na

Details for d5ltlb_

PDB Entry: 5ltl, 1.45 Å

PDB Description: structure of human chemokine ccl16

PDB Compounds: (B:) C-C motif chemokine 16

SCOPe Domain Sequences for d5ltlb_:

Sequence; same for both SEQRES and ATOM records:

>d5ltlb_ d.9.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vntpstcclkyyekvlprrlvvgyrkalnchlpaiifvtkrnrevctnpnddwvqeyikd
pnlpllptr

Timeline for d5ltlb_:

• d5ltlb_ first appeared in SCOPe 2.07