Lineage for d6fr6a2 (6fr6 A:116-201)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 3051804Domain d6fr6a2: 6fr6 A:116-201 [351866]
    Other proteins in same PDB: d6fr6a1
    automated match to d1j8hd2
    complexed with so4

Details for d6fr6a2

PDB Entry: 6fr6 (more details), 2.98 Å

PDB Description: ha1.7 human t-cell receptor specific for influenza virus epitope pkyvkqntlklat presented by human leukocyte antigen hla-dr0101
PDB Compounds: (A:) Human T-cell receptor alpha chain

SCOPe Domain Sequences for d6fr6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fr6a2 b.1.1.2 (A:116-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

SCOPe Domain Coordinates for d6fr6a2:

Click to download the PDB-style file with coordinates for d6fr6a2.
(The format of our PDB-style files is described here.)

Timeline for d6fr6a2:

  • d6fr6a2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-10