Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza a virus [TaxId:947380] [351836] (1 PDB entry) |
Domain d6d8we1: 6d8w E:3-324 [351857] Other proteins in same PDB: d6d8wa2, d6d8wb2, d6d8wb3, d6d8wb4, d6d8wc2, d6d8wc3, d6d8wd2, d6d8we2, d6d8wf2 automated match to d4wsrd1 complexed with fmt, nag, oxm |
PDB Entry: 6d8w (more details), 2.35 Å
SCOPe Domain Sequences for d6d8we1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d8we1 b.19.1.0 (E:3-324) automated matches {Influenza a virus [TaxId: 947380]} dticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagw ilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpka tswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvh hpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdti tfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvti gecpkyvkstqlrmatglrnip
Timeline for d6d8we1: