Lineage for d6euba_ (6eub A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560176Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 2560177Protein automated matches [190726] (1 species)
    not a true protein
  7. 2560178Species Human (Homo sapiens) [TaxId:9606] [187887] (32 PDB entries)
  8. 3051793Domain d6euba_: 6eub A: [351855]
    automated match to d4m7ha_
    complexed with 1pe

Details for d6euba_

PDB Entry: 6eub (more details), 2.3 Å

PDB Description: the fibrinogen-like domain of human angptl4
PDB Compounds: (A:) Angiopoietin-related protein 4

SCOPe Domain Sequences for d6euba_:

Sequence, based on SEQRES records: (download)

>d6euba_ d.171.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprdcqelfqvgerqsglfeiqpqgsppflvnckmtsdggwtviqrrhdgsvdfnrpwea
ykagfgdphgefwlglekvhsitgdrnsrlavqlrdwdgnaellqfsvhlggedtayslq
ltapvagqlgattvppsglsvpfstwdqdhdlrrdkncakslsggwwfgtcshsnlngqy
frsipqqrqklkkgifwktwrgryyplqattmliqpm

Sequence, based on observed residues (ATOM records): (download)

>d6euba_ d.171.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprdcqelfqvgerqsglfeiqpqgsppflvnckmtsdggwtviqrrhdgsvdfnrpwea
ykagfgdphgefwlglekvhsitgdrnsrlavqlrdwdgnaellqfsvhlggedtayslq
ltapvagqlgattvppsglsvpfstwdqdhdlrrdkncakslsggwwfgtcshsnlngqy
frsipqrqklkkgifwktwrgryyplqattmliqpm

SCOPe Domain Coordinates for d6euba_:

Click to download the PDB-style file with coordinates for d6euba_.
(The format of our PDB-style files is described here.)

Timeline for d6euba_:

  • d6euba_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09