SCOPe 2.08: Domain d6d8wb2: 6d8w B:330-494

Lineage for d6d8wb2 (6d8w B:330-494)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus [TaxId:947380] [351838] (1 PDB entry)

8. Domain d6d8wb2: 6d8w B:330-494 [351843]
   Other proteins in same PDB: d6d8wa1, d6d8wb1, d6d8wb3, d6d8wb4, d6d8wc1, d6d8wc3, d6d8wd1, d6d8we1, d6d8wf1
   automated match to d4wsrd2
   complexed with fmt, nag, oxm

Details for d6d8wb2

PDB Entry: 6d8w, 2.35 Å

PDB Description: crystal structure of invbi.18715.a.kn11: influenza hemagglutinin from strain a/jiangsu/alsi/2011

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6d8wb2:

Sequence; same for both SEQRES and ATOM records:

>d6d8wb2 h.3.1.0 (B:330-494) automated matches {Influenza a virus [TaxId: 947380]}
glfgaiagfieggwtgmvdgwygyhhrneqgsgyaadqkstqiaidgisnkvnsviekmn
iqftsvgkefnslekrmenlnkkvddgfldvwtynaellillenertldfhdlnvknlye
kvksqlrnnakeigngcfefyhkcdnecmesvkngtynypkysee

Timeline for d6d8wb2:

• d6d8wb2 first appeared in SCOPe 2.07