Lineage for d6d8wf1 (6d8w F:3-324)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.19: Viral protein domain [49817] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll; form trimersSuperfamily b.19.1: Viral protein domain [49818] (4 families) 
forms homotrimers
Family b.19.1.0: automated matches [227246] (1 protein)
not a true familyProtein automated matches [227017] (58 species)
not a true protein
Species Influenza a virus [TaxId:947380] [351836] (1 PDB entry) 
Domain d6d8wf1: 6d8w F:3-324 [351837]
Other proteins in same PDB: d6d8wa2, d6d8wb2, d6d8wb3, d6d8wb4, d6d8wc2, d6d8wc3, d6d8wd2, d6d8we2, d6d8wf2
automated match to d4wsrd1
complexed with fmt, nag, oxm
Details for d6d8wf1
PDB Entry: 6d8w (more details), 2.35 Å
PDB Description: crystal structure of invbi.18715.a.kn11: influenza hemagglutinin from strain a/jiangsu/alsi/2011
PDB Compounds: (F:) HemagglutininSCOPe Domain Sequences for d6d8wf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d8wf1 b.19.1.0 (F:3-324) automated matches {Influenza a virus [TaxId: 947380]}
dticvgyhannstdtvdtileknvtvthsvnllenshngklcslngkiplqlgncnvagw
ilgnpkcdllltanswsyiietsnskngacypgefadyeelkeqlstvssferfeifpka
tswpnhdttrgttvacshsgansfyrnllwivkkgnsypklsksytnnkgkevlviwgvh
hpptdsdqqtlyqnnhtyvsvgsskyykrltpeivarpkvreqagrmnyywtlldqgdti
tfeatgnliapwhafalkkgsssgimrsdaqvhncttkcqtphgalkgnlpfqnvhpvti
gecpkyvkstqlrmatglrnip
SCOPe Domain Coordinates for d6d8wf1:
Click to download the PDB-style file with coordinates for d6d8wf1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6d8wf1:
- d6d8wf1 first appeared in SCOPe 2.07
View in 3D
