Lineage for d6cfva_ (6cfv A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491190Family c.108.1.10: Predicted hydrolases Cof [82388] (12 protein domains)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2491215Protein Phosphomannomutase 1 [142161] (1 species)
  7. 2491216Species Human (Homo sapiens) [TaxId:9606] [142162] (2 PDB entries)
    Uniprot Q92871 12-256
  8. 3051769Domain d6cfva_: 6cfv A: [351831]
    automated match to d2fuca1
    complexed with imp, mg

Details for d6cfva_

PDB Entry: 6cfv (more details), 1.92 Å

PDB Description: structure of human alpha-phosphomannomutase 1 in complex with inosine monophosphate
PDB Compounds: (A:) Phosphomannomutase 1

SCOPe Domain Sequences for d6cfva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cfva_ c.108.1.10 (A:) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}
ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie
kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief
rngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdv
fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr
eiffp

SCOPe Domain Coordinates for d6cfva_:

Click to download the PDB-style file with coordinates for d6cfva_.
(The format of our PDB-style files is described here.)

Timeline for d6cfva_:

  • d6cfva_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-09