Lineage for d6cgua2 (6cgu A:100-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763600Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. 2763610Domain d6cgua2: 6cgu A:100-207 [351825]
    automated match to d3lnda2
    complexed with ca

Details for d6cgua2

PDB Entry: 6cgu (more details), 1.9 Å

PDB Description: mouse cadherin-6 ec1-2 adhesive fragment
PDB Compounds: (A:) Cadherin-6

SCOPe Domain Sequences for d6cgua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cgua2 b.1.6.0 (A:100-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ndnepiftkdvytatvpemadvgtfvvqvtatdaddptygnsakvvysilqgqpyfsves
etgiiktallnmdrenreqyqvviqakdmggqmgglsgtttvnitltd

SCOPe Domain Coordinates for d6cgua2:

Click to download the PDB-style file with coordinates for d6cgua2.
(The format of our PDB-style files is described here.)

Timeline for d6cgua2: