Lineage for d5ysba1 (5ysb A:35-414)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 3051651Species Listeria innocua [TaxId:272626] [351713] (4 PDB entries)
  8. 3051753Domain d5ysba1: 5ysb A:35-414 [351815]
    Other proteins in same PDB: d5ysba2, d5ysbb2
    automated match to d2zyma_
    complexed with peg, zn

Details for d5ysba1

PDB Entry: 5ysb (more details), 2.2 Å

PDB Description: crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form
PDB Compounds: (A:) Lin1841 protein

SCOPe Domain Sequences for d5ysba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ysba1 c.94.1.0 (A:35-414) automated matches {Listeria innocua [TaxId: 272626]}
kvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqmg
ttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfyr
tdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfdk
dgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntlk
dtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswlk
dtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrgg
advqtqmdtfndqveallkk

SCOPe Domain Coordinates for d5ysba1:

Click to download the PDB-style file with coordinates for d5ysba1.
(The format of our PDB-style files is described here.)

Timeline for d5ysba1:

  • d5ysba1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5ysba2