Lineage for d5muqb2 (5muq B:113-219)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 3051746Domain d5muqb2: 5muq B:113-219 [351808]
    Other proteins in same PDB: d5muqb1, d5muql1
    automated match to d3okka2
    complexed with imd, zn

Details for d5muqb2

PDB Entry: 5muq (more details), 2.62 Å

PDB Description: crystal structure of dc8e8 fab at ph 7.0 containing a zn atom
PDB Compounds: (B:) antibody kappa light chain

SCOPe Domain Sequences for d5muqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5muqb2 b.1.1.2 (B:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5muqb2:

Click to download the PDB-style file with coordinates for d5muqb2.
(The format of our PDB-style files is described here.)

Timeline for d5muqb2:

  • d5muqb2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5muqb1