Lineage for d6bplb2 (6bpl B:329-579)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (138 species)
    not a true protein
  7. 3051564Species Escherichia coli [TaxId:83334] [351626] (2 PDB entries)
  8. 3051721Domain d6bplb2: 6bpl B:329-579 [351783]
    Other proteins in same PDB: d6bpla1, d6bplb1
    automated match to d3b60a1
    complexed with 3pe, au7, dao, dpo, ftt, gcs, glc, gmh, kdo, myr, pa1, po4

Details for d6bplb2

PDB Entry: 6bpl (more details), 2.91 Å

PDB Description: e. coli msba in complex with lps and inhibitor g907
PDB Compounds: (B:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d6bplb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bplb2 c.37.1.0 (B:329-579) automated matches {Escherichia coli [TaxId: 83334]}
degkrvieratgdvefrnvtftypgrdvpalrninlkipagktvalvgrsgsgkstiasl
itrfydidegeilmdghdlreytlaslrnqvalvsqnvhlfndtvanniayarteqysre
qieeaarmayamdfinkmdngldtvigengvllsggqrqriaiarallrdspilildeat
saldteseraiqaaldelqknrtslviahrlstiekadeivvvedgvivergthndlleh
rgvyaqlhkmq

SCOPe Domain Coordinates for d6bplb2:

Click to download the PDB-style file with coordinates for d6bplb2.
(The format of our PDB-style files is described here.)

Timeline for d6bplb2:

  • d6bplb2 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d6bplb1