SCOPe 2.08: Domain d5muql1: 5muq L:1-112

Lineage for d5muql1 (5muq L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5muql1: 5muq L:1-112 [351767]
   Other proteins in same PDB: d5muqa1, d5muqa2, d5muqb2, d5muqh1, d5muqh2, d5muql2
   automated match to d3okla1
   complexed with imd, zn

Details for d5muql1

PDB Entry: 5muq, 2.62 Å

PDB Description: crystal structure of dc8e8 fab at ph 7.0 containing a zn atom

PDB Compounds: (L:) antibody kappa light chain

SCOPe Domain Sequences for d5muql1:

Sequence; same for both SEQRES and ATOM records:

>d5muql1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsfylrtfgggtkldik

Timeline for d5muql1:

• d5muql1 first appeared in SCOPe 2.07