Lineage for d5vm4i1 (5vm4 I:5-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743840Domain d5vm4i1: 5vm4 I:5-129 [351751]
    Other proteins in same PDB: d5vm4a2, d5vm4b2, d5vm4c2, d5vm4d2, d5vm4e2, d5vm4f2, d5vm4g2, d5vm4h2, d5vm4i2, d5vm4j2, d5vm4k2, d5vm4l2
    automated match to d4w81a_
    complexed with act, fmt

Details for d5vm4i1

PDB Entry: 5vm4 (more details), 1.9 Å

PDB Description: the apo form of the triclocarban-binding single domain camelid nanobody vhh t10
PDB Compounds: (I:) single domain camelid nanobody VHH T10

SCOPe Domain Sequences for d5vm4i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vm4i1 b.1.1.1 (I:5-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
klqqsgggmvqtgdslrlscvgsrralsstivgwfrqipgkerefvggiawsssdtwyad
svkgrftiskddaangvhlqmsslkpedtavyycasalrrpgsdasdytripdypywgqg
tqvtv

SCOPe Domain Coordinates for d5vm4i1:

Click to download the PDB-style file with coordinates for d5vm4i1.
(The format of our PDB-style files is described here.)

Timeline for d5vm4i1: