Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries) |
Domain d5ymtn_: 5ymt N: [351737] automated match to d5gj6a_ complexed with gal, glc, nag |
PDB Entry: 5ymt (more details), 2.2 Å
SCOPe Domain Sequences for d5ymtn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ymtn_ b.29.1.0 (N:) automated matches {Human rotavirus a [TaxId: 10941]} vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
Timeline for d5ymtn_: