SCOPe 2.08: Domain d5ysea1: 5yse A:35-414

Lineage for d5ysea1 (5yse A:35-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Listeria innocua [TaxId:272626] [351713] (4 PDB entries)

8. Domain d5ysea1: 5yse A:35-414 [351720]
   Other proteins in same PDB: d5ysea2, d5yseb2
   automated match to d2zyma_
   complexed with mg, mpd

Details for d5ysea1

PDB Entry: 5yse, 1.6 Å

PDB Description: crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose

PDB Compounds: (A:) Lin1841 protein

SCOPe Domain Sequences for d5ysea1:

Sequence; same for both SEQRES and ATOM records:

>d5ysea1 c.94.1.0 (A:35-414) automated matches {Listeria innocua [TaxId: 272626]}
kvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqmg
ttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfyr
tdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfdk
dgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntlk
dtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswlk
dtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrgg
advqtqmdtfndqveallkk

Timeline for d5ysea1:

• d5ysea1 first appeared in SCOPe 2.07