Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries) |
Domain d5xjle_: 5xjl E: [351697] Other proteins in same PDB: d5xjla_, d5xjlb_ automated match to d4f7uh_ |
PDB Entry: 5xjl (more details), 2.5 Å
SCOPe Domain Sequences for d5xjle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjle_ b.38.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq lgrimlkgdnitllqsv
Timeline for d5xjle_:
View in 3D Domains from other chains: (mouse over for more information) d5xjla_, d5xjlb_, d5xjlf_, d5xjlg_ |