SCOPe 2.08: Domain d5nw7a_: 5nw7 A:

Lineage for d5nw7a_ (5nw7 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein automated matches [351675] (1 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [351676] (1 PDB entry)

8. Domain d5nw7a_: 5nw7 A: [351677]
   automated match to d1pmia_
   complexed with 9c2, zn

Details for d5nw7a_

PDB Entry: 5nw7, 1.85 Å

PDB Description: crystal structure of candida albicans phosphomannose isomerase in complex with inhibitor

PDB Compounds: (A:) Mannose-6-phosphate isomerase

SCOPe Domain Sequences for d5nw7a_:

Sequence; same for both SEQRES and ATOM records:

>d5nw7a_ b.82.1.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
sseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpyaelwmgthpsvpska
idlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiekvlsiqahpdkklgaq
lhaadpknypddnhkpemaiavtdfegfcgfkpldqlaktlatvpelneiigqelvdefi
sgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtakllertdrepqvfkdidsr
lpeliqrlnkqfpndiglfcgclllnhvglnkgeamflqakdphayisgdiiecmaasdn
vvragftpkfkdvknlvemltysyesvekqkmplqefprskgdavksvlydppiaefsvl
qtifdkskggkqvieglngpsiviatngkgtiqitgddstkqkidtgyvffvapgssiel
tadsanqdqdfttyrafvea

Timeline for d5nw7a_:

• d5nw7a_ first appeared in SCOPe 2.07