Lineage for d6bppa1 (6bpp A:4-328)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580483Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 2580484Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 2580485Family f.37.1.1: ABC transporter transmembrane region [90124] (4 proteins)
  6. 3051559Protein automated matches [351621] (2 species)
    not a true protein
  7. 3051560Species Escherichia coli [TaxId:83334] [351622] (2 PDB entries)
  8. 3051562Domain d6bppa1: 6bpp A:4-328 [351624]
    Other proteins in same PDB: d6bppa2, d6bppb2
    automated match to d3b60a2
    complexed with 3pe, dao, e1m, ftt, gcs, glc, gmh, kdo, myr, pa1, po4

Details for d6bppa1

PDB Entry: 6bpp (more details), 2.92 Å

PDB Description: e. coli msba in complex with lps and inhibitor g092
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d6bppa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bppa1 f.37.1.1 (A:4-328) automated matches {Escherichia coli [TaxId: 83334]}
dkdlstwqtfrrlwptiapfkaglivagvalilnaasdtfmlsllkpllddgfgktdrsv
lvwmplvviglmilrgitsyvssyciswvsgkvvmtmrrrlfghmmgmpvsffdkqstgt
llsritydseqvassssgalitvvregasiiglfimmfyyswqlsiilivlapivsiair
vvskrfrnisknmqntmgqvttsaeqmlkghkevlifggqevetkrfdkvsnrmrlqgmk
mvsassisdpiiqliaslalafvlyaasfpsvmdsltagtitvvfssmialmrplksltn
vnaqfqrgmaacqtlftildseqek

SCOPe Domain Coordinates for d6bppa1:

Click to download the PDB-style file with coordinates for d6bppa1.
(The format of our PDB-style files is described here.)

Timeline for d6bppa1:

  • d6bppa1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-03

View in 3D
Domains from same chain:
(mouse over for more information)
d6bppa2