SCOPe 2.08: Domain d5weqa2: 5weq A:108-212

Lineage for d5weqa2 (5weq A:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5weqa2: 5weq A:108-212 [351618]
   Other proteins in same PDB: d5weqa1, d5weqb_
   automated match to d3idxl2
   mutant

Details for d5weqa2

PDB Entry: 5weq, 2 Å

PDB Description: the crystal structure of a mr78 mutant

PDB Compounds: (A:) MR78 mutant light chain

SCOPe Domain Sequences for d5weqa2:

Sequence; same for both SEQRES and ATOM records:

>d5weqa2 b.1.1.2 (A:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

Timeline for d5weqa2:

• d5weqa2 first appeared in SCOPe 2.07