SCOPe 2.08: Domain d6czpd1: 6czp D:1-217

Lineage for d6czpd1 (6czp D:1-217)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)

6. Protein automated matches [190153] (5 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [351434] (1 PDB entry)

8. Domain d6czpd1: 6czp D:1-217 [351590]
   Other proteins in same PDB: d6czpa2, d6czpb2, d6czpc2, d6czpd2, d6czpe2, d6czpf2, d6czph2
   automated match to d1icub_
   complexed with cl, fmn, gol, peg, pge

Details for d6czpd1

PDB Entry: 6czp, 2.24 Å

PDB Description: 2.2 angstrom resolution crystal structure oxygen-insensitive nad(p)h- dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn

PDB Compounds: (D:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d6czpd1:

Sequence; same for both SEQRES and ATOM records:

>d6czpd1 d.90.1.1 (D:1-217) automated matches {Vibrio vulnificus [TaxId: 672]}
mtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkari
akatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmhag
rsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglre
kgftsvvivplgyhseddfnaklpksrwsaetvftei

Timeline for d6czpd1:

• d6czpd1 first appeared in SCOPe 2.07