Lineage for d5xsuc2 (5xsu C:136-350)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558127Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2558128Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2558416Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2558417Protein automated matches [191197] (9 species)
    not a true protein
  7. 2558470Species Human (Homo sapiens) [TaxId:9606] [225406] (41 PDB entries)
  8. 3051505Domain d5xsuc2: 5xsu C:136-350 [351567]
    Other proteins in same PDB: d5xsua1, d5xsub1, d5xsuc1, d5xsud1
    automated match to d4hhyd2
    complexed with 8e3, so4

Details for d5xsuc2

PDB Entry: 5xsu (more details), 2.4 Å

PDB Description: novel orally efficacious inhibitors complexed with parp1
PDB Compounds: (C:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5xsuc2:

Sequence, based on SEQRES records: (download)

>d5xsuc2 d.166.1.0 (C:136-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Sequence, based on observed residues (ATOM records): (download)

>d5xsuc2 d.166.1.0 (C:136-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5xsuc2:

Click to download the PDB-style file with coordinates for d5xsuc2.
(The format of our PDB-style files is described here.)

Timeline for d5xsuc2:

  • d5xsuc2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-26