Lineage for d6f4cb1 (6f4c B:52-324)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417057Protein automated matches [190099] (29 species)
    not a true protein
  7. 3051484Species Nicotiana benthamiana [TaxId:4100] [351546] (1 PDB entry)
  8. 3051485Domain d6f4cb1: 6f4c B:52-324 [351547]
    Other proteins in same PDB: d6f4cb2
    automated match to d1uasa2

Details for d6f4cb1

PDB Entry: 6f4c (more details), 2.8 Å

PDB Description: nicotiana benthamiana alpha-galactosidase
PDB Compounds: (B:) alpha-galactosidase

SCOPe Domain Sequences for d6f4cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f4cb1 c.1.8.1 (B:52-324) automated matches {Nicotiana benthamiana [TaxId: 4100]}
lsnglgrtpqmgwsswnhfacnieekeiretadamvstglaslgyeyiniddcwaelnrd
sqgnmvpkgstfpsgikaladyvhskglklgiysdagsqtcskqmtgslgheeqdaktfa
swgvdylkydncnnenrsprerypimakalknsgraifyslcewgdddpatwassvgnsw
rttgdisdnwdsmtsradmndewasyagpggwndpdmlevgnggmttaeyrshfsiwala
kapliigcdlrsmdqtaheilsnkeviavnqdk

SCOPe Domain Coordinates for d6f4cb1:

Click to download the PDB-style file with coordinates for d6f4cb1.
(The format of our PDB-style files is described here.)

Timeline for d6f4cb1:

  • d6f4cb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from same chain:
(mouse over for more information)
d6f4cb2