SCOPe 2.08: Domain d5xj4l_: 5xj4 L:

Lineage for d5xj4l_ (5xj4 L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5xj4l_: 5xj4 L: [351544]
   Other proteins in same PDB: d5xj4h_
   automated match to d4qo1a_

Details for d5xj4l_

PDB Entry: 5xj4, 2.3 Å

PDB Description: complex structure of durvalumab-scfv/pd-l1

PDB Compounds: (L:) durvalumab-VL

SCOPe Domain Sequences for d5xj4l_:

Sequence; same for both SEQRES and ATOM records:

>d5xj4l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqrvsssylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygslpwtfgqgtkveikrgggg

Timeline for d5xj4l_:

• d5xj4l_ first appeared in SCOPe 2.07