Lineage for d5xj4l_ (5xj4 L:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1236 PDB entries)
  8. 3051482Domain d5xj4l_: 5xj4 L: [351544]
    Other proteins in same PDB: d5xj4h_
    automated match to d4qo1a_

Details for d5xj4l_

PDB Entry: 5xj4 (more details), 2.3 Å

PDB Description: complex structure of durvalumab-scfv/pd-l1
PDB Compounds: (L:) durvalumab-VL

SCOPe Domain Sequences for d5xj4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xj4l_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqrvsssylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygslpwtfgqgtkveikrgggg

SCOPe Domain Coordinates for d5xj4l_:

Click to download the PDB-style file with coordinates for d5xj4l_.
(The format of our PDB-style files is described here.)

Timeline for d5xj4l_:

  • d5xj4l_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-26

View in 3D
Domains from other chains:
(mouse over for more information)
d5xj4h_