Lineage for d5xsma3 (5xsm A:532-677)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488687Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2488688Protein automated matches [226991] (9 species)
    not a true protein
  7. 2488741Species Scheffersomyces stipitis [TaxId:322104] [328851] (23 PDB entries)
  8. 2488745Domain d5xsma3: 5xsm A:532-677 [351533]
    Other proteins in same PDB: d5xsma1, d5xsma2
    automated match to d1gpua3
    complexed with 8eo, ca, peg

Details for d5xsma3

PDB Entry: 5xsm (more details), 0.97 Å

PDB Description: crystal structure of transketolase in complex with tpp intermediate iv from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5xsma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xsma3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5xsma3:

Click to download the PDB-style file with coordinates for d5xsma3.
(The format of our PDB-style files is described here.)

Timeline for d5xsma3: