Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
Species Escherichia coli [TaxId:562] [53674] (63 PDB entries) Uniprot P00479 |
Domain d1raea1: 1rae A:1-150 [35152] Other proteins in same PDB: d1raeb1, d1raeb2, d1raed1, d1raed2 complexed with ctp, zn; mutant |
PDB Entry: 1rae (more details), 2.5 Å
SCOPe Domain Sequences for d1raea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1raea1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1raea1: