Lineage for d5oaeb_ (5oae B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327758Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2327759Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2327826Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2327827Protein automated matches [254708] (3 species)
    not a true protein
  7. 2327828Species Bacillus megaterium [TaxId:1404] [255981] (20 PDB entries)
  8. 3051437Domain d5oaeb_: 5oae B: [351499]
    automated match to d4p6ra_
    complexed with cu, svf

Details for d5oaeb_

PDB Entry: 5oae (more details), 2.7 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with svf inhibitor in the active site
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d5oaeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oaeb_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
yrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmssa
flpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikdf
ivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwdm
tsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqii
hrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

SCOPe Domain Coordinates for d5oaeb_:

Click to download the PDB-style file with coordinates for d5oaeb_.
(The format of our PDB-style files is described here.)

Timeline for d5oaeb_:

  • d5oaeb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-26