Lineage for d6czpg_ (6czp G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963381Protein automated matches [190153] (5 species)
    not a true protein
  7. 2963422Species Vibrio vulnificus [TaxId:672] [351434] (1 PDB entry)
  8. 2963429Domain d6czpg_: 6czp G: [351449]
    Other proteins in same PDB: d6czpa2, d6czpb2, d6czpc2, d6czpd2, d6czpe2, d6czpf2, d6czph2
    automated match to d1icub_
    complexed with cl, fmn, gol, peg, pge

Details for d6czpg_

PDB Entry: 6czp (more details), 2.24 Å

PDB Description: 2.2 angstrom resolution crystal structure oxygen-insensitive nad(p)h- dependent nitroreductase nfsb from vibrio vulnificus in complex with fmn
PDB Compounds: (G:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d6czpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6czpg_ d.90.1.1 (G:) automated matches {Vibrio vulnificus [TaxId: 672]}
mtivqaaqsrystkafdasrklpeekvaavkelirmsassvnsqpwhfivasseegkari
akatqggfafnerkildashvvvfcaktaideaylldllesedkdgrfadveakngmhag
rsffvnmhrfdlkdahhwmekqvylnvgtlllgasameidavpiegfdakvldeefglre
kgftsvvivplgyhseddfnaklpksrwsaetvftei

SCOPe Domain Coordinates for d6czpg_:

Click to download the PDB-style file with coordinates for d6czpg_.
(The format of our PDB-style files is described here.)

Timeline for d6czpg_: