Lineage for d6b0ta2 (6b0t A:141-259)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792682Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2792799Family b.42.5.0: automated matches [267627] (1 protein)
    not a true family
  6. 2792800Protein automated matches [267678] (1 species)
    not a true protein
  7. 2792801Species Human (Homo sapiens) [TaxId:9606] [267866] (2 PDB entries)
  8. 2792811Domain d6b0ta2: 6b0t A:141-259 [351384]
    automated match to d3llpa2
    complexed with c7v

Details for d6b0ta2

PDB Entry: 6b0t (more details), 2.8 Å

PDB Description: structural insights into the induced-fit inhibition of fascin by a small molecule
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d6b0ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b0ta2 b.42.5.0 (A:141-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

SCOPe Domain Coordinates for d6b0ta2:

Click to download the PDB-style file with coordinates for d6b0ta2.
(The format of our PDB-style files is described here.)

Timeline for d6b0ta2: