SCOPe 2.08: Domain d5xiwa2: 5xiw A:246-437

Lineage for d5xiwa2 (5xiw A:246-437)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d5xiwa2: 5xiw A:246-437 [351377]
Other proteins in same PDB: d5xiwa1, d5xiwb1, d5xiwc1, d5xiwd1, d5xiwe_, d5xiwf1, d5xiwf2, d5xiwf3
automated match to d4i50a2
complexed with ca, gdp, gol, gtp, loc, mes, mg

Details for d5xiwa2

PDB Entry: 5xiw (more details), 2.9 Å

PDB Description: crystal structure of t2r-ttl-colchicine complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xiwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xiwa2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5xiwa2:

Click to download the PDB-style file with coordinates for d5xiwa2.
(The format of our PDB-style files is described here.)

Timeline for d5xiwa2: