Lineage for d6anea_ (6ane A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902426Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)
  8. 2902460Domain d6anea_: 6ane A: [351372]
    Other proteins in same PDB: d6aneb2
    automated match to d5xfya_
    complexed with mg

Details for d6anea_

PDB Entry: 6ane (more details), 2.02 Å

PDB Description: crystal structure of ideonella sakaiensis pet hydrolase
PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6anea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6anea_ c.69.1.0 (A:) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

SCOPe Domain Coordinates for d6anea_:

Click to download the PDB-style file with coordinates for d6anea_.
(The format of our PDB-style files is described here.)

Timeline for d6anea_: