Lineage for d5xqwl1 (5xqw L:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (175 PDB entries)
  8. 3051308Domain d5xqwl1: 5xqw L:1-107 [351370]
    Other proteins in same PDB: d5xqwl2
    automated match to d1c12a1
    complexed with 8eu

Details for d5xqwl1

PDB Entry: 5xqw (more details), 2.2 Å

PDB Description: catalytic antibody 7b9
PDB Compounds: (L:) Fab fragment of catalytic antibody 7B9, light chain

SCOPe Domain Sequences for d5xqwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqwl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqqpssmsvslgdtvtitchasqgirsnigwlqqkpgksfkgliylgtnledevps
rfsgsgsgadysltisslesedfadyycvqyaqfprtfgggtrleik

SCOPe Domain Coordinates for d5xqwl1:

Click to download the PDB-style file with coordinates for d5xqwl1.
(The format of our PDB-style files is described here.)

Timeline for d5xqwl1:

  • d5xqwl1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-19