Lineage for d6cw0b_ (6cw0 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (13 species)
    not a true protein
  7. 3051293Species Cryptosporidium parvum [TaxId:5807] [351355] (1 PDB entry)
  8. 3051299Domain d6cw0b_: 6cw0 B: [351361]
    automated match to d4qnsc_
    complexed with gol, r78, so4, unx

Details for d6cw0b_

PDB Entry: 6cw0 (more details), 1.38 Å

PDB Description: crystal structure of cryptosporidium parvum bromodomain cgd2_2690
PDB Compounds: (B:) Cgd2_2690 protein

SCOPe Domain Sequences for d6cw0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cw0b_ a.29.2.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
dysreysevllqlkelqdseaflepvnwkklglddypdivknpmdlktigkkikanfytk
aeqfwadidliwhncqlynhessevyqqsirmqdaannlrdml

SCOPe Domain Coordinates for d6cw0b_:

Click to download the PDB-style file with coordinates for d6cw0b_.
(The format of our PDB-style files is described here.)

Timeline for d6cw0b_:

  • d6cw0b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-19