Lineage for d5xt8b_ (5xt8 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (146 species)
    not a true protein
  7. 2452994Species Thermus thermophilus [TaxId:300852] [272710] (19 PDB entries)
  8. 3051236Domain d5xt8b_: 5xt8 B: [351298]
    automated match to d3n2ia_
    complexed with cl, edo, mg

Details for d5xt8b_

PDB Entry: 5xt8 (more details), 2.01 Å

PDB Description: magnesium bound apo structure of thymidylate kinase (form i) from thermus thermophilus hb8
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5xt8b_:

Sequence, based on SEQRES records: (download)

>d5xt8b_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlp
eeeiaraiqahlrpllp

Sequence, based on observed residues (ATOM records): (download)

>d5xt8b_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
lkprltflldlppeaalrrvlgleffrrvregylalaraepgrfvvldatlpeeeiarai
qahlrpllp

SCOPe Domain Coordinates for d5xt8b_:

Click to download the PDB-style file with coordinates for d5xt8b_.
(The format of our PDB-style files is described here.)

Timeline for d5xt8b_:

  • d5xt8b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-19