Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
Domain d5xkga2: 5xkg A:246-437 [351285] Other proteins in same PDB: d5xkga1, d5xkgb1, d5xkgc1, d5xkgd1, d5xkge_, d5xkgf1, d5xkgf2, d5xkgf3 automated match to d4i50a2 complexed with 890, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5xkg (more details), 2.2 Å
SCOPe Domain Sequences for d5xkga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xkga2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d5xkga2: