Lineage for d5mxwa_ (5mxw A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975642Species Yellow lupine (Lupinus luteus) [TaxId:3873] [186854] (4 PDB entries)
  8. 2975646Domain d5mxwa_: 5mxw A: [351254]
    automated match to d2qima_
    complexed with ml1, na, unl, zea

Details for d5mxwa_

PDB Entry: 5mxw (more details), 1.57 Å

PDB Description: crystal structure of yellow lupin llpr-10.2b protein in complex with melatonin and trans-zeatin.
PDB Compounds: (A:) Class 10 plant pathogenesis-related protein

SCOPe Domain Sequences for d5mxwa_:

Sequence, based on SEQRES records: (download)

>d5mxwa_ d.129.3.1 (A:) automated matches {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
geskyvlhkieaideanlgynysivggvglpdtiekisfetklveganggsigkvtikie
tkgdaqpneeegkaakargdaffkaiesylsahpdy

Sequence, based on observed residues (ATOM records): (download)

>d5mxwa_ d.129.3.1 (A:) automated matches {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvftfqdeytstiapaklykalvtdadiiipkavetiqsveivegnggpgtikkltfieg
geskyvlhkieaideanlgynysivggvgldtiekisfetklveganggsigkvtikiet
kgdaqpneeegkaakargdaffkaiesylsahpdy

SCOPe Domain Coordinates for d5mxwa_:

Click to download the PDB-style file with coordinates for d5mxwa_.
(The format of our PDB-style files is described here.)

Timeline for d5mxwa_: